Thalassiosira pseudonana: THAPSDRAFT_262598 Help Entry THAPSDRAFT_262598 CDS       T01078                                  Name (RefSeq) dna-directed RNA polymerase i   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism tps  Thalassiosira pseudonana Pathway tps03020   RNA polymerase tps03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tps00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     THAPSDRAFT_262598   09124 Replication and repair    03420 Nucleotide excision repair     THAPSDRAFT_262598  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tps03021]     THAPSDRAFT_262598    03400 DNA repair and recombination proteins [BR:tps03400]     THAPSDRAFT_262598 Transcription machinery [BR:tps03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      THAPSDRAFT_262598   RNA polymerase III system    RNA polymerase III      THAPSDRAFT_262598   RNA polymerase I system    RNA polymerase I      THAPSDRAFT_262598 DNA repair and recombination proteins [BR:tps03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       THAPSDRAFT_262598 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  7448182 NCBI-ProteinID:  XP_002290360 JGI:  262598 UniProt:  B8C3F5 LinkDB All DBs Position 5:1665157..1665387 Genome browser AA seq 76 aa AA seqDB search RITTRYLTKYERARVLGTRALQISMNAPVMVDLEGETDPLKIAQKELRERKIPIVIRRYL PDGSHEDWGIDELIVD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt agaatcacgacgcgatatttgaccaagtatgaacgagcgagagtgctgggaacacgtgct ttgcagattagtatgaatgcaccggtgatggtggatttggagggggagacggatccactc aagattgctcagaaggagttaagggagaggaagattccaattgtgatcaggcgatattta cctgatggaagtcacgaggattgggggattgatgagttgattgtggattag

DBGET integrated database retrieval system