Thalassiosira pseudonana: THAPSDRAFT_38815 Help Entry THAPSDRAFT_38815  CDS       T01078                                  Symbol Rpb8 Name (RefSeq) RNA polymerase   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism tps  Thalassiosira pseudonana Pathway tps03020   RNA polymerase tps03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tps00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     THAPSDRAFT_38815 (Rpb8)   09124 Replication and repair    03420 Nucleotide excision repair     THAPSDRAFT_38815 (Rpb8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tps03021]     THAPSDRAFT_38815 (Rpb8)    03400 DNA repair and recombination proteins [BR:tps03400]     THAPSDRAFT_38815 (Rpb8) Transcription machinery [BR:tps03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      THAPSDRAFT_38815 (Rpb8)   RNA polymerase III system    RNA polymerase III      THAPSDRAFT_38815 (Rpb8)   RNA polymerase I system    RNA polymerase I      THAPSDRAFT_38815 (Rpb8) DNA repair and recombination proteins [BR:tps03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       THAPSDRAFT_38815 (Rpb8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  7448892 NCBI-ProteinID:  XP_002295166 JGI:  38815 UniProt:  B8CGC8 LinkDB All DBs Position 23:284217..284678 Genome browser AA seq 153 aa AA seqDB search MATATSARVTLFEDIFEITHLNPEGKKFDLVNRLSATGTTFECDLLLDYNCQIYSLLEGE KMTLVLASTLNLDGTPDDHTSYNPATSHNNELTLADNYEYVMHGRVFDVSYKKDGVVVIA ISFGGLLCRLTGDQRHLSSVLPDMRLYVLIKKD NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaccgcaacctccgcccgcgtaaccctcttcgaagacatcttcgaaatcacccac ctcaaccccgaaggcaaaaaattcgacctcgtcaaccgcctctccgccacgggaaccacc ttcgaatgcgacctcctcctcgactacaactgtcaaatctactcattactggagggtgaa aagatgactttggtcctagcgtccactcttaatttagatggaactcccgatgatcatacc agttacaatccggcgacgtctcataataacgagttgacactggcggataattatgagtat gttatgcatgggagggtgtttgatgttagttataagaaggatggggttgtggttattgct atttcgtttggggggttgttgtgtaggttgacgggggatcagaggcatttgagcagtgtt ttgccagatatgaggttgtatgttttgattaagaaggattag

DBGET integrated database retrieval system