Thermacetogenium phaeum: Tph_c28870 Help Entry Tph_c28870        CDS       T02276                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tpz  Thermacetogenium phaeum Pathway tpz00020   Citrate cycle (TCA cycle) tpz01100   Metabolic pathways tpz01110   Biosynthesis of secondary metabolites tpz01120   Microbial metabolism in diverse environments tpz01200   Carbon metabolism tpz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tpz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Tph_c28870 Enzymes [BR:tpz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Tph_c28870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_16 Fer4_17 Fer4_8 Fer4_6 Fer4_4 Fer4_10 Fer4_22 Whib Fer4_3 Motif Other DBs NCBI-ProteinID:  AFV13052 UniProt:  K4LLS0 LinkDB All DBs Position complement(2905719..2905982) Genome browser AA seq 87 aa AA seqDB search MEKKKAITTEVNKGKAIFSLFPGLCKGCGLCREKCPEKALNWSEKLGVYGTPTVIPDPAL CKACRICEQVCPDCAIAIMRKDGDKDK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaaaagaagaaagcgatcaccaccgaggtcaataaagggaaggcgatcttctctctg tttcccgggctctgtaagggctgcggcctctgccgggaaaagtgcccggagaaagccttg aactggtcggagaagctgggggtttacgggactcccaccgtgattccggatcccgccctc tgcaaggcctgccggatctgtgagcaggtctgcccggactgcgccatcgccattatgcgc aaagatggggataaggataagtga

DBGET integrated database retrieval system