Trichomycterus rosablanca: 134314789 Help Entry 134314789         CDS       T09921                                  Symbol igf1 Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism trn  Trichomycterus rosablanca Pathway trn04010   MAPK signaling pathway trn04068   FoxO signaling pathway trn04114   Oocyte meiosis trn04115   p53 signaling pathway trn04150   mTOR signaling pathway trn04510   Focal adhesion trn04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:trn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134314789 (igf1)    04068 FoxO signaling pathway     134314789 (igf1)    04150 mTOR signaling pathway     134314789 (igf1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     134314789 (igf1)    04115 p53 signaling pathway     134314789 (igf1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     134314789 (igf1)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     134314789 (igf1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:trn04052]     134314789 (igf1) Cytokines and neuropeptides [BR:trn04052]  Cytokines   Growth factors (RTK binding)    134314789 (igf1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  134314789 NCBI-ProteinID:  XP_062851580 LinkDB All DBs Position 1:complement(67971494..67986886) Genome browser AA seq 145 aa AA seqDB search MRCLALGRVPAPMLLLCALTLAPVKVWAGPETLCGAELVDTLQFVCGDRGFYFSKPTGYG PSSRRLHNRGIVDECCFQSCELRRLEMYCAPVKSGKAPRSVREQRHTDGSKTPKKPISSH SHASCKDVHQKNSSRGNTGGRNYRM NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcgctgcctggcactgggccgcgtgcccgctccgatgctgctgctgtgcgcgctcacg ctggcgccggtgaaagtgtgggcggggcctgagacgctgtgcggggcggagctagtggac acgctacagtttgtgtgtggagaccgaggcttttatttcagcaagccaacaggttatggc cccagttcacggcgcttgcacaaccgtggcattgtggatgaatgctgctttcagagttgt gagttgagacggttggagatgtattgcgccccagttaaatctggtaaagcaccacgatct gtacgagaacaacggcatacagatggatcaaaaacaccaaagaaacctatatctagtcac agccacgcatcctgtaaggatgttcatcagaagaactcaagccgagggaacactgggggg agaaactatcgaatgtag

DBGET integrated database retrieval system