Candidatus Thiothrix sulfatifontis: L3K52_17160 Help Entry L3K52_17160       CDS       T09924                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism tsj  Candidatus Thiothrix sulfatifontis Pathway tsj00790   Folate biosynthesis tsj01100   Metabolic pathways tsj01240   Biosynthesis of cofactors Module tsj_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:tsj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     L3K52_17160 (folB) Enzymes [BR:tsj01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      L3K52_17160 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      L3K52_17160 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      L3K52_17160 (folB) BRITE hierarchy Motif Pfam:  FolB DUF294 Motif Other DBs NCBI-ProteinID:  UOG91893 LinkDB All DBs Position 3432153..3432524 Genome browser AA seq 123 aa AA seqDB search MDIVYVRDLRLDARIGIYEWEKRILQKIRIDLEMAWDNRIPAASDAIKDTLNYKTAAKRV MQLVDSAHYELVERLAETIAETLMQELHIPWIQVTVGKPGAVRGASEVGVKIERGNRQWQ TSI NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggatatagtttatgtacgcgacctgcgcctcgatgcccgcatcggcatttacgagtgg gaaaaacgcatcctgcaaaaaattcgcattgatttggaaatggcgtgggataaccgcatc cccgccgccagcgacgccattaaagacaccctcaactacaaaaccgctgccaagcgtgtc atgcaactggtcgacagcgctcattacgaattagtcgagcgcctcgcagaaaccatcgca gaaaccctcatgcaagaattgcacattccttggatacaagtcaccgtcggcaaacccggc gcagtacgcggtgcgagcgaagtcggtgttaaaattgaacgtggcaatcggcaatggcaa acgtctatttaa

DBGET integrated database retrieval system