Candidatus Thiodictyon syntrophicum: THSYN_18925 Help Entry THSYN_18925       CDS       T05211                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism tsy  Candidatus Thiodictyon syntrophicum Pathway tsy00190   Oxidative phosphorylation tsy01100   Metabolic pathways tsy02020   Two-component system Module tsy_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:tsy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     THSYN_18925  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     THSYN_18925 Enzymes [BR:tsy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      THSYN_18925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AUB82807 UniProt:  A0A2K8UB98 LinkDB All DBs Position 4542614..4542736 Genome browser AA seq 40 aa AA seqDB search MWYFAWLLGVLLAVAFGIINVMWYESEQCFGQADDEGLSA NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggctgctgggcgtgctgttggcggtggccttcggcatcatcaat gtcatgtggtatgagtcggagcagtgcttcggccaggccgacgacgaggggctgtccgcc tga

DBGET integrated database retrieval system