Teredinibacter turnerae: TERTU_4066 Help Entry TERTU_4066        CDS       T00952                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism ttu  Teredinibacter turnerae Pathway ttu00261   Monobactam biosynthesis ttu01100   Metabolic pathways ttu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ttu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     TERTU_4066  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ttu01008]     TERTU_4066 Polyketide biosynthesis proteins [BR:ttu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     TERTU_4066 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Lpp-LpqN Motif Other DBs NCBI-ProteinID:  ACR12481 UniProt:  C5BUC3 LinkDB All DBs Position 4498278..4498535 Genome browser AA seq 85 aa AA seqDB search MSTFNEETINPFDNPAHTFLVLTNQQQEYSLWPTFVPTPKGWEPQFGPASRDECSAYVET HWTAGPLFPNTESARAHNPESREGI NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgttcaatgaagaaaccatcaatccttttgacaaccccgctcatacctttctg gtgctcaccaaccagcagcaggaatacagcttgtggccgacctttgtgcccacgcctaaa ggctgggaaccgcaattcggccccgcctcgcgggatgaatgcagcgcatacgtagaaacc cactggactgccgggcccttatttccaaataccgagtctgcgcgcgcccacaatccagaa tcgcgggagggcatctga

DBGET integrated database retrieval system