Tachysurus vachellii: 132856574 Help Entry 132856574         CDS       T09596                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism tvc  Tachysurus vachellii Pathway tvc04010   MAPK signaling pathway tvc04012   ErbB signaling pathway tvc04068   FoxO signaling pathway tvc04137   Mitophagy - animal tvc04140   Autophagy - animal tvc04150   mTOR signaling pathway tvc04210   Apoptosis tvc04218   Cellular senescence tvc04370   VEGF signaling pathway tvc04371   Apelin signaling pathway tvc04540   Gap junction tvc04625   C-type lectin receptor signaling pathway tvc04810   Regulation of actin cytoskeleton tvc04910   Insulin signaling pathway tvc04912   GnRH signaling pathway tvc04914   Progesterone-mediated oocyte maturation tvc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tvc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132856574 (kras)    04012 ErbB signaling pathway     132856574 (kras)    04370 VEGF signaling pathway     132856574 (kras)    04371 Apelin signaling pathway     132856574 (kras)    04068 FoxO signaling pathway     132856574 (kras)    04150 mTOR signaling pathway     132856574 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132856574 (kras)    04137 Mitophagy - animal     132856574 (kras)   09143 Cell growth and death    04210 Apoptosis     132856574 (kras)    04218 Cellular senescence     132856574 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     132856574 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132856574 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132856574 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     132856574 (kras)    04912 GnRH signaling pathway     132856574 (kras)    04914 Progesterone-mediated oocyte maturation     132856574 (kras)    04916 Melanogenesis     132856574 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tvc04131]     132856574 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tvc04031]     132856574 (kras) Membrane trafficking [BR:tvc04131]  Endocytosis   Macropinocytosis    Ras GTPases     132856574 (kras) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132856574 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  132856574 NCBI-ProteinID:  XP_060742159 LinkDB All DBs Position 14:complement(12190304..12198355) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKLSKEEETPRC IKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctggtggtggtcggagctggaggcgttggaaaaagtgctctgacc atccagctcatccagaaccactttgtagatgaatatgaccctactatagaggactcgtac aggaagcaggtggtgattgacggagagacgtgtttgttggacatcctggacacagcaggt caggaggagtacagcgccatgagagatcagtacatgaggacaggggagggcttcctctgt gtatttgccattaataacaccaagtcttttgaggacattcaccactacagagagcagatt aagagagtgaaagactctgaggatgtgcctatggtcctggtgggaaataagtgtgacctg ccatcccgcacagtggataccaagcaggctcaggatttagcacgtagctatggaattcct ttcatcgagacctcggcaaaaacgagacagagagtggaggatgccttttacactctggtc cgggagatcaggcaatacagactgaaaaaactcagcaaagaagaagagacgccgaggtgc atcaagcttaaaaaatgtgttgtgatgtga

DBGET integrated database retrieval system