Thiorhodovibrio winogradskyi: Thiowin_00891 Help Entry Thiowin_00891     CDS       T09736                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism twg  Thiorhodovibrio winogradskyi Pathway twg00261   Monobactam biosynthesis twg01100   Metabolic pathways twg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:twg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Thiowin_00891  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:twg01008]     Thiowin_00891 Polyketide biosynthesis proteins [BR:twg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Thiowin_00891 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WPL15961 LinkDB All DBs Position 966919..967131 Genome browser AA seq 70 aa AA seqDB search MTPIEKADQTLWRVVVNHEEQYSIWPVDQTLPLGWTDIGKQGVKSECLEHIETVWTDLRP LSLRLQLQQY NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgactccgatagagaaagccgatcaaaccctttggcgtgttgtcgtcaatcacgaagaa caatactcgatttggcctgtcgatcaaacactccccttgggttggacggacattggcaag cagggggtcaagtcagaatgtctcgagcacattgagacagtctggaccgacttacgtcca ttaagccttcgcctgcaattacaacaatattaa

DBGET integrated database retrieval system