Thermodesulfovibrio yellowstonii: THEYE_A0616 Help Entry THEYE_A0616       CDS       T00775                                  Name (GenBank) conserved domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism tye  Thermodesulfovibrio yellowstonii Pathway tye00020   Citrate cycle (TCA cycle) tye01100   Metabolic pathways tye01110   Biosynthesis of secondary metabolites tye01120   Microbial metabolism in diverse environments tye01200   Carbon metabolism tye01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:tye00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     THEYE_A0616 Enzymes [BR:tye01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      THEYE_A0616 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_6 Fer4_2 Fer4 Fer4_21 Fer4_9 Fer4_10 Fer4_17 Fer4_15 Fer4_8 Fer4_13 Fer4_16 Fer4_4 Fer4_18 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  ACI20872 UniProt:  B5YJP4 LinkDB All DBs Position complement(604910..605137) Genome browser AA seq 75 aa AA seqDB search MQTKVKKGLIVIDSERCKGCNYCGLTCPKGCIEISSDFNSSGYFPAKFSNPANCIGCAMC AVVCPEIAIEVFVED NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcaaacaaaggtaaaaaaaggcttaattgtaattgattcggaaagatgtaaaggctgt aattactgtggtttgacatgtccaaaaggctgtattgaaatttcttctgattttaattct tcaggatatttccctgctaaattttctaatcctgctaattgtataggatgcgcaatgtgt gcagttgtttgccctgaaatagctatagaagtcttcgtagaggattaa

DBGET integrated database retrieval system