Umezawaea sp. Da 62-37: RM788_38930 Help Entry RM788_38930       CDS       T09853                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ume  Umezawaea sp. Da 62-37 Pathway ume00261   Monobactam biosynthesis ume01100   Metabolic pathways ume01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ume00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RM788_38930  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ume01008]     RM788_38930 Polyketide biosynthesis proteins [BR:ume01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RM788_38930 BRITE hierarchy Motif Pfam:  MbtH YjeF_N Motif Other DBs NCBI-ProteinID:  WNV84094 LinkDB All DBs Position 8538982..8539194 Genome browser AA seq 70 aa AA seqDB search MSANPFDQEDGVYLVLVNAERQHSLWPAAIEIPSGWTTAHGKDTRQACLDYVEAHWTDLR PASLVAAMTN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcgccaacccgttcgaccaggaagacggcgtctacctggtcctggtcaacgccgaa cgccagcactccctgtggcccgcggcgatcgagatcccgtccggttggaccaccgcgcac ggcaaggacacccggcaggcgtgcctggactacgtcgaggcgcactggaccgacctccgc ccggcgagcctcgtcgcggcgatgaccaactga

DBGET integrated database retrieval system