Umezawaea sp. Da 62-37: RM788_41060 Help Entry RM788_41060       CDS       T09853                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ume  Umezawaea sp. Da 62-37 Pathway ume00261   Monobactam biosynthesis ume01100   Metabolic pathways ume01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ume00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RM788_41060  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ume01008]     RM788_41060 Polyketide biosynthesis proteins [BR:ume01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RM788_41060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH dGTP_diPhyd_N Motif Other DBs NCBI-ProteinID:  WNV84494 UniProt:  A0AA96TKK0 LinkDB All DBs Position 9033318..9033536 Genome browser AA seq 72 aa AA seqDB search MTNPFDDQNGSFLVLVNDEGQYCVWPSFAEVPPGWTVALGEGSREAALSYVEENWTDMRP RSLREQSATRAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtgacgaacccctttgacgaccagaacgggtcgttcctagtgctggtcaacgacgaaggc cagtactgcgtgtggccctcgttcgccgaggtgccccccggctggaccgtggcgctcggc gagggcagcagagaggcagccctgtcctacgtggaggagaactggacggacatgcgtccc aggagcctccgcgagcagtccgccacccgcgcgggctga

DBGET integrated database retrieval system