Variovorax paradoxus S110: Vapar_3750 Help Entry Vapar_3750        CDS       T00916                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism vap  Variovorax paradoxus S110 Pathway vap00261   Monobactam biosynthesis vap01100   Metabolic pathways vap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vap00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Vapar_3750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vap01008]     Vapar_3750 Polyketide biosynthesis proteins [BR:vap01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Vapar_3750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACS20366 UniProt:  C5CUF3 LinkDB All DBs Position 1:complement(3968801..3969058) Genome browser AA seq 85 aa AA seqDB search MSTSCFDREDETFIVLVNHEDQYSIWPHWKAVPKGWTAVEGVKGDKKTVLAHVEQNWTDM RPRSLREWMAQQNPATGTAAQTTAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgagctgcttcgatcgcgaagacgagaccttcatcgttctggtcaaccacgaa gaccagtactccatctggccccactggaaggccgtgccgaagggatggacggcggtcgag ggcgtcaagggcgacaagaagaccgtgctggcccacgtcgagcagaactggaccgacatg cgtccccgctcgctgcgcgaatggatggcgcagcagaacccggcgaccggaactgcagcc caaaccacggctggctga

DBGET integrated database retrieval system