Vigna angularis (adzuki bean): 108321590 Help Entry 108321590         CDS       T04660                                  Name (RefSeq) dihydroneopterin aldolase 2-like   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism var  Vigna angularis (adzuki bean) Pathway var00790   Folate biosynthesis var01100   Metabolic pathways var01240   Biosynthesis of cofactors Module var_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:var00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     108321590 Enzymes [BR:var01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      108321590  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      108321590  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      108321590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  108321590 NCBI-ProteinID:  XP_017408877 UniProt:  A0A0L9TD37 LinkDB All DBs Position Un Genome browser AA seq 132 aa AA seqDB search MESEALIWGDKLLLRGLSFHGFHGALPEERKLGQKFVVDIDAWMDLKQAGKSDNLSDTVS YADIYYLAKDIVEGSAQNLLESVAEKIAVMTLTDHEQISAVRVKIEKPHVAVHGPLDYLG VEIFRRRAHLSN NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggagtctgaggcactgatatggggagacaaactcttactgagaggattgtcgttccat ggttttcacggagcattacctgaagagaggaaattaggtcaaaagttcgtggtagacatt gatgcatggatggatctcaaacaagctggcaaatctgacaacttatcagatactgttagt tacgcagatatatattacttagctaaggacattgttgaagggtcagctcagaatcttctg gaatcagtagctgaaaaaattgcagtgatgactctgacagatcatgaacaaatatctgct gttcgtgtgaagattgaaaagcctcatgtggcagttcatggtccacttgattatttaggt gttgagatatttcgacgcagagctcatttgtcaaattag

DBGET integrated database retrieval system