Nibricoccus aquaticus HZ-65: CMV30_11820 Help Entry CMV30_11820       CDS       T05426                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vbh  Nibricoccus aquaticus HZ-65 Pathway vbh00790   Folate biosynthesis vbh01100   Metabolic pathways vbh01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:vbh00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CMV30_11820 (folB) Enzymes [BR:vbh01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CMV30_11820 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CMV30_11820 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CMV30_11820 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ATC64586 UniProt:  A0A290QEA4 LinkDB All DBs Position 2954680..2955045 Genome browser AA seq 121 aa AA seqDB search MNARIHLRNMAFYGYHGHLTAENALGQRFQIDLTLTTDIARATKTDDLADTVDYVNIYAM CREVVEGAHVKLLETLAGRIMDRVLADFASVQKVEITIRKPSVPLPGVLDHVSLETSKSR E NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaacgcacgcatccatcttcggaacatggctttttatggctaccacggccatctgacg gcggagaacgcgctggggcagcggtttcaaatcgatctgacgctgacgacggacatcgcg cgggcgacgaagacggacgatctggcggacacggtggactacgtgaacatctatgcgatg tgccgcgaggtggttgaaggcgcgcatgtgaagctgctcgaaacgctggcggggcggatc atggatcgcgtgctggcggatttcgcgagtgtgcagaaagtggagatcacgattcgcaag ccgtcggtgccgctgccgggggtgctggatcatgtgtcgctcgaaaccagtaaatcccgt gagtga

DBGET integrated database retrieval system