Verrucosispora sp. NA02020: HUT12_06265 Help Entry HUT12_06265       CDS       T06958                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ver  Verrucosispora sp. NA02020 Pathway ver00261   Monobactam biosynthesis ver01100   Metabolic pathways ver01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ver00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HUT12_06265  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ver01008]     HUT12_06265 Polyketide biosynthesis proteins [BR:ver01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HUT12_06265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QKW12440 UniProt:  A0A7H8K6J6 LinkDB All DBs Position 1452782..1453000 Genome browser AA seq 72 aa AA seqDB search MTQPDDVRFKVVVNHEEQYSVWWSDRPNPPGWQDEGTDGTRQECLDHIDRVWKDMRPRSV RTVREAIQGAQA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacgcagccggatgacgtccgtttcaaggtcgtggtcaaccacgaggagcagtactcg gtgtggtggtcggaccggcccaacccgccgggctggcaggacgagggcaccgacggcacc cgtcaggagtgcctcgaccacatcgaccgggtgtggaaggacatgcggccgcgcagcgtg cggaccgttcgggaagcgatccagggagcgcaggcatga

DBGET integrated database retrieval system