Verrucosispora sp. NA02020: HUT12_30375 Help Entry HUT12_30375       CDS       T06958                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ver  Verrucosispora sp. NA02020 Pathway ver00790   Folate biosynthesis ver01100   Metabolic pathways ver01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ver00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HUT12_30375 (folB) Enzymes [BR:ver01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HUT12_30375 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HUT12_30375 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HUT12_30375 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QKW16622 UniProt:  A0A7H8KKP3 LinkDB All DBs Position complement(6790365..6790730) Genome browser AA seq 121 aa AA seqDB search MTDRIALTGLRAHGRHGVYDFERARGQEFVVDVVLELDLGPAARSDDVADTVHYGELADG LVAVITGEPVDLIESLADRLIEVCLTDPRVSAATVTVHKPEAPIPHAFGDVAVTMRRTRT R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccggatcgcgctgaccggcctgcgggcccacggccggcacggcgtgtacgac ttcgagcgcgcccgggggcaggagttcgtcgtcgacgtcgtcctggagctggacctcggc cccgccgcgcgctccgacgacgtcgccgacactgtgcactacggcgagctggccgacggc ctcgtcgcggtgatcaccggcgagccggtcgacctgatcgagtcgctggccgaccgcctg atcgaggtctgcctgaccgatccacgggtgtccgccgcgacggtgaccgtgcacaaaccc gaggcgccgatcccgcacgccttcggcgacgtggccgtgacgatgcgccggacgcgtacc cgatga

DBGET integrated database retrieval system