Viridibacillus sp. JNUCC-6: JNUCC6_01525 Help Entry JNUCC6_01525      CDS       T06874                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism vij  Viridibacillus sp. JNUCC-6 Pathway vij00261   Monobactam biosynthesis vij01100   Metabolic pathways vij01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vij00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JNUCC6_01525  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vij01008]     JNUCC6_01525 Polyketide biosynthesis proteins [BR:vij01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JNUCC6_01525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QOV11496 UniProt:  A0A7M2QUI0 LinkDB All DBs Position 318943..319164 Genome browser AA seq 73 aa AA seqDB search MSNPFENENGIYNVLINEEGQHSLWPSFLVIPEGWSVIYSEESRQDCLEYINKNWTDLQP KSLKLVASSDGTK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccttttgagaatgaaaatggtatctataatgtattgataaatgaagaaggt cagcattccctatggccctcctttctggttattccagaaggctggtccgtcatatactcg gaggaaagccgacaggattgcttggagtacattaacaagaactggacggatttgcagcca aaaagtttgaaattagttgcgagtagtgatggaacaaagtga

DBGET integrated database retrieval system