Virgibacillus sp. SK37: X953_00495 Help Entry X953_00495        CDS       T03219                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vir  Virgibacillus sp. SK37 Pathway vir00790   Folate biosynthesis vir01100   Metabolic pathways vir01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:vir00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     X953_00495 Enzymes [BR:vir01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      X953_00495  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      X953_00495  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      X953_00495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIF42015 UniProt:  A0A075JJS7 LinkDB All DBs Position 94713..95078 Genome browser AA seq 121 aa AA seqDB search MDKIVLKNLQFYGYHGLLPEENKLGQRFQVDVDLYANLKKPGETDAMEDSIHYGHAYELI QQVVEGEPYNLIEAVAEKIANELLRSFTLLSACTVKVIKPDPPIPGHYHSVAVEIYRERS I NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggataagattgtactaaaaaatctgcagttttatggatatcatggcttattgccagaa gagaataagcttggtcaaagatttcaagtggatgtagacttgtatgcgaatttaaagaag ccgggtgaaacagatgcaatggaagattctattcattacgggcatgcgtacgagttaatt cagcaagttgtggagggtgagccatacaacttaattgaagcagttgctgagaaaattgct aacgagctgttacgttcttttactcttttatccgcgtgtacggttaaagtgatcaagcca gaccctcctattccagggcattatcactctgttgctgtggaaatatatagggagagatca atatga

DBGET integrated database retrieval system