Vibrio kanaloae: BTD91_04315 Help Entry BTD91_04315       CDS       T07086                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vka  Vibrio kanaloae Pathway vka00790   Folate biosynthesis vka01100   Metabolic pathways vka01240   Biosynthesis of cofactors Module vka_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vka00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BTD91_04315 (folB) Enzymes [BR:vka01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BTD91_04315 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BTD91_04315 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BTD91_04315 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QPK05655 UniProt:  A0A7T0E5W0 LinkDB All DBs Position 1:complement(1009147..1009467) Genome browser AA seq 106 aa AA seqDB search MTTIGVYDWEQEIKQKLVLDIEMAHDNRPAGKSDDVVDALDYSTVSTAVLEHIANGRFLL VERVAEEVAELIMTQFSVPWIKIRLAKPGAVPQAKAVGVIIERGQA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt attacaacgatcggtgtttacgattgggagcaagagattaaacaaaaacttgtgctcgat attgaaatggctcatgacaaccgcccagctggcaagagtgatgatgtggttgatgctttg gactactcgacagtgagcacggccgtacttgaacatattgctaatggccgattcctattg gttgaacgtgtagcagaagaagtcgctgaattaattatgactcaattttcagtgccttgg attaagatccgtttagcgaagcctggcgcggtaccacaagcaaaagccgttggcgtgatc atcgaaagaggtcaggcatga

DBGET integrated database retrieval system