Micromonospora maris: VAB18032_22125 Help Entry VAB18032_22125    CDS       T01471                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism vma  Micromonospora maris Pathway vma00261   Monobactam biosynthesis vma01100   Metabolic pathways vma01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vma00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     VAB18032_22125  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vma01008]     VAB18032_22125 Polyketide biosynthesis proteins [BR:vma01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     VAB18032_22125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEB45525 UniProt:  F4F5W6 LinkDB All DBs Position 3919431..3919646 Genome browser AA seq 71 aa AA seqDB search MSVADDDAEYVVVSNDEEQFSLWLTGRNLPNGWREAGKRGSREECLAYIEQVWTDMRPRS LREFAARSSTR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgtggcggacgacgacgccgaatacgtggtggtctccaacgacgaggagcagttc tctctctggttgaccggacgtaacctgcccaacggctggcgcgaggccggcaagcggggc agccgcgaggagtgcctcgcctacatcgaacaggtctggaccgacatgcgaccgcgcagc ctgcgcgagttcgcggcccggtcgtcgacgcggtga

DBGET integrated database retrieval system