Variovorax paradoxus B4: VAPA_1c40280 Help Entry VAPA_1c40280      CDS       T02835                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism vpd  Variovorax paradoxus B4 Pathway vpd00261   Monobactam biosynthesis vpd01100   Metabolic pathways vpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     VAPA_1c40280  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vpd01008]     VAPA_1c40280 Polyketide biosynthesis proteins [BR:vpd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     VAPA_1c40280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGU51106 UniProt:  T1XF38 LinkDB All DBs Position 1:complement(4281017..4281226) Genome browser AA seq 69 aa AA seqDB search MSNPFDDKNASFLVLVNHEGQHSLWPAFIAVPAGWQVALAATDRAACDAFIEANWVDMRP RSLVAAGGG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgacgacaagaacgccagctttctggtgctggtgaaccacgagggg cagcactcgctgtggcccgccttcatcgccgtacccgccggctggcaggtggcgctggca gcgaccgaccgggccgcctgcgacgcattcatcgaagcgaactgggtcgacatgcggccg cgctcgctggtggccgccggcggcggctga

DBGET integrated database retrieval system