Variovorax paradoxus EPS: Varpa_4517 Help Entry Varpa_4517        CDS       T01392                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism vpe  Variovorax paradoxus EPS Pathway vpe00261   Monobactam biosynthesis vpe01100   Metabolic pathways vpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vpe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Varpa_4517  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vpe01008]     Varpa_4517 Polyketide biosynthesis proteins [BR:vpe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Varpa_4517 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADU38684 UniProt:  E6UV90 LinkDB All DBs Position complement(4900207..4900419) Genome browser AA seq 70 aa AA seqDB search MSNPLDDKNASFQVLVNDEGQHSLWPAFIAVPAGWQVALAPTDRDACSAYIEANWQDMRP RSLVAATAAG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcccttggacgacaagaacgccagcttccaggtgctggtgaacgacgagggc cagcactcgctgtggcccgccttcatcgccgtgcctgccggctggcaggtcgcgctggcg ccgaccgaccgcgacgcctgcagcgcctacatcgaggcgaactggcaggacatgcggccg cgctcgctggtggcggccacggcggcaggctga

DBGET integrated database retrieval system