Vigna radiata (mung bean): 106756013 Help Entry 106756013         CDS       T04126                                  Name (RefSeq) dihydroneopterin aldolase 1-like   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vra  Vigna radiata (mung bean) Pathway vra00790   Folate biosynthesis vra01100   Metabolic pathways vra01240   Biosynthesis of cofactors Module vra_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vra00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     106756013 Enzymes [BR:vra01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      106756013  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      106756013  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      106756013 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  106756013 NCBI-ProteinID:  XP_014493733 UniProt:  A0A1S3TIX8 LinkDB All DBs Position 2:complement(22816418..22818970) Genome browser AA seq 113 aa AA seqDB search MHSWGDKLVLRGLSFHGFQGAKPEERKLGQKFVVDIDAWMDLAAAGKTDHLSDTLSYTAI YDIAKEILEGSPHNLLKSVAQKIAITILTNHNEIFVVRVKVGKPHVAVRGPVE NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcactcgtggggagacaaactcgtactgaggggattgtcattccatggctttcaggga gcaaagccagaagaaaggaaactaggccagaagttcgtggtagatatagatgcttggatg gatcttgcagctgctggaaaaactgatcacttatcagatacactcagttacacagcaata tatgatatagccaaggaaattcttgaagggtcacctcacaaccttctgaaatcagtggcc caaaaaattgcaataactattctcacaaatcataatgaaatttttgtcgttcgagtgaag gttggaaagcctcatgtggcagttcgaggtccagttgagtaa

DBGET integrated database retrieval system