Vigna radiata (mung bean): 106777055 Help Entry 106777055         CDS       T04126                                  Name (RefSeq) dihydroneopterin aldolase 2   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism vra  Vigna radiata (mung bean) Pathway vra00790   Folate biosynthesis vra01100   Metabolic pathways vra01240   Biosynthesis of cofactors Module vra_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vra00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     106777055 Enzymes [BR:vra01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      106777055  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      106777055  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      106777055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-GeneID:  106777055 NCBI-ProteinID:  XP_014520048 UniProt:  A0A1S3VNT3 LinkDB All DBs Position 11:8863122..8864787 Genome browser AA seq 132 aa AA seqDB search MESNALPCGDKLVLRGLSFHGFHGAKPEERKLGQKFVVDIDAWMDLATAGKTDHLSDTVS YTAIYDIVKEVLEGSPHNLLESVAQKIAITTLTNHKEIFAVRVKVEKPHVAVQGPVDYLG VEIHRRRSDLSG NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggaatctaatgcactgccatgtggagacaaactcgtactgaggggattgtcattccat ggttttcatggagcaaagccagaagaaaggaaactgggccagaagttcgtggtagatata gatgcttggatggatctcgcaactgctggcaaaactgatcacttatctgatacagttagt tacacagcaatatatgatatagttaaggaagttcttgaagggtcacctcacaaccttctg gaatcagtggcccaaaaaattgcaataactactctgacaaatcataaagaaatttttgct gttcgagtgaaggttgaaaagcctcatgtggcagttcaaggtccagttgattacttaggc gttgagattcatagacggagaagcgatttgtcaggctaa

DBGET integrated database retrieval system