Vibrio ruber: RND59_14995 Help Entry RND59_14995       CDS       T09542                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism vru  Vibrio ruber Pathway vru00261   Monobactam biosynthesis vru01100   Metabolic pathways vru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vru00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RND59_14995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:vru01008]     RND59_14995 Polyketide biosynthesis proteins [BR:vru01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RND59_14995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WNJ95410 LinkDB All DBs Position 1:complement(3333801..3333995) Genome browser AA seq 64 aa AA seqDB search MSEQYVNPFDDPENQFLVLINQCGQYSLWPDFKPTPSGWKHTFGPSDKQRCIAYIEAHWQ DIRV NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgtcagaacaatacgttaacccttttgatgatcctgaaaatcagtttcttgtcctgatc aaccaatgcggtcagtacagcctgtggcctgattttaaaccgacgccttccggttggaaa catacgttcgggcccagtgataaacagcgttgcatcgcatacatcgaagcccattggcaa gacatccgggtatag

DBGET integrated database retrieval system