Vulpes vulpes (red fox): 112916797 Help Entry 112916797         CDS       T05911                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism vvp  Vulpes vulpes (red fox) Pathway vvp01523   Antifolate resistance vvp04010   MAPK signaling pathway vvp04060   Cytokine-cytokine receptor interaction vvp04064   NF-kappa B signaling pathway vvp04217   Necroptosis vvp04380   Osteoclast differentiation vvp04620   Toll-like receptor signaling pathway vvp04621   NOD-like receptor signaling pathway vvp04623   Cytosolic DNA-sensing pathway vvp04625   C-type lectin receptor signaling pathway vvp04640   Hematopoietic cell lineage vvp04657   IL-17 signaling pathway vvp04659   Th17 cell differentiation vvp04668   TNF signaling pathway vvp04750   Inflammatory mediator regulation of TRP channels vvp04932   Non-alcoholic fatty liver disease vvp04933   AGE-RAGE signaling pathway in diabetic complications vvp04936   Alcoholic liver disease vvp04940   Type I diabetes mellitus vvp05010   Alzheimer disease vvp05020   Prion disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05132   Salmonella infection vvp05133   Pertussis vvp05134   Legionellosis vvp05135   Yersinia infection vvp05140   Leishmaniasis vvp05142   Chagas disease vvp05143   African trypanosomiasis vvp05144   Malaria vvp05146   Amoebiasis vvp05152   Tuberculosis vvp05162   Measles vvp05163   Human cytomegalovirus infection vvp05164   Influenza A vvp05168   Herpes simplex virus 1 infection vvp05171   Coronavirus disease - COVID-19 vvp05321   Inflammatory bowel disease vvp05323   Rheumatoid arthritis vvp05332   Graft-versus-host disease vvp05417   Lipid and atherosclerosis vvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112916797 (IL1B)    04064 NF-kappa B signaling pathway     112916797 (IL1B)    04668 TNF signaling pathway     112916797 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112916797 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112916797 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112916797 (IL1B)    04620 Toll-like receptor signaling pathway     112916797 (IL1B)    04621 NOD-like receptor signaling pathway     112916797 (IL1B)    04623 Cytosolic DNA-sensing pathway     112916797 (IL1B)    04625 C-type lectin receptor signaling pathway     112916797 (IL1B)    04659 Th17 cell differentiation     112916797 (IL1B)    04657 IL-17 signaling pathway     112916797 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     112916797 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     112916797 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112916797 (IL1B)    05164 Influenza A     112916797 (IL1B)    05162 Measles     112916797 (IL1B)    05168 Herpes simplex virus 1 infection     112916797 (IL1B)    05163 Human cytomegalovirus infection     112916797 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     112916797 (IL1B)    05135 Yersinia infection     112916797 (IL1B)    05133 Pertussis     112916797 (IL1B)    05134 Legionellosis     112916797 (IL1B)    05152 Tuberculosis     112916797 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     112916797 (IL1B)    05144 Malaria     112916797 (IL1B)    05140 Leishmaniasis     112916797 (IL1B)    05142 Chagas disease     112916797 (IL1B)    05143 African trypanosomiasis     112916797 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     112916797 (IL1B)    05321 Inflammatory bowel disease     112916797 (IL1B)    05332 Graft-versus-host disease     112916797 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     112916797 (IL1B)    05020 Prion disease     112916797 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     112916797 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112916797 (IL1B)    05418 Fluid shear stress and atherosclerosis     112916797 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112916797 (IL1B)    04936 Alcoholic liver disease     112916797 (IL1B)    04932 Non-alcoholic fatty liver disease     112916797 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     112916797 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     112916797 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112916797 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:vvp00536]     112916797 (IL1B) Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Interleukins    112916797 (IL1B) Glycosaminoglycan binding proteins [BR:vvp00536]  Heparan sulfate / Heparin   Cytokines    112916797 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep CoV_Methyltr_2 Motif Other DBs NCBI-GeneID:  112916797 NCBI-ProteinID:  XP_025850447 UniProt:  A0A3Q7RVJ7 LinkDB All DBs Position Unknown AA seq 265 aa AA seqDB search MAAVPELTSEMMAYSSNNENDVFFEADGPGNVKCCCQDLNHSSLVDEGIQLQVSHQLCNK SLRHFVSVIVALEKLKKPCPQVLQGDDLKSIFRYIFEEEPIICKTDADNFMSDAALPSVD CTLQDINHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNYKIPVVLGIKQKNL YLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQV EGMPVFLGNTKGGQDITDFTMEFSS NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacccgaactcaccagtgaaatgatggcttactccagtaacaatgagaat gacgtattctttgaagctgatggccctggaaacgtgaagtgctgctgccaagacctgaac cacagttctctggtagatgagggcatccagttgcaagtctcccaccagctctgtaacaag agtctgaggcatttcgtgtcagtcattgtagctttggagaagctgaagaagccctgccca caggtcctccagggggatgacctgaagagcatctttcgctacatctttgaagaagaacct atcatctgcaaaacagatgcagataattttatgagtgatgcagccctgccatcggtggac tgcacgttacaggacataaaccacaaatacctggtgctgtctaactcgtatgagcttcgg gctctccacctcaatggggaaaatgtgaacaaacaagtggtgttccacatgagctttgtg cacggagatgaaagtaattacaagatacctgtggtcttgggcatcaaacaaaagaatctg tacctgtcctgtgtgatgaaggatgggaagcccaccctacagctagagaaggtagacccc aaagtctacccaaagaggaagatggaaaagcgatttgtcttcaacaagatagaaatcaag aacacagtggaatttgagtcttctcagtaccctaactggtacatcagcacctctcaagtc gaaggaatgcctgtcttcctaggaaataccaaaggtggccaggatataactgacttcacc atggaattctcttcctag

DBGET integrated database retrieval system