Wansuia hejianensis: H9Q79_03365 Help Entry H9Q79_03365       CDS       T08122                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism whj  Wansuia hejianensis Pathway whj00020   Citrate cycle (TCA cycle) whj01100   Metabolic pathways whj01110   Biosynthesis of secondary metabolites whj01120   Microbial metabolism in diverse environments whj01200   Carbon metabolism whj01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:whj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     H9Q79_03365 Enzymes [BR:whj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      H9Q79_03365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_4 Fer4_9 Fer4_21 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_17 Fer4_3 Fer4_22 TSCPD Motif Other DBs NCBI-ProteinID:  QNM09341 UniProt:  A0A7G9GEV9 LinkDB All DBs Position 715442..715639 Genome browser AA seq 65 aa AA seqDB search MAVYIDKELCKSCKICMNICPKNVFEITHHVNKKGYNYVEAVREEDCISCGQCETSCPDF VIHVE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggcggtatatattgataaggagctttgcaaaagctgtaaaatctgcatgaatatctgt ccgaagaacgtgtttgagatcactcatcatgtgaataagaaaggatataactatgtggaa gcagtcagagaagaagactgcataagctgcggccagtgtgagacatcctgccctgatttc gttattcacgtggaatga

DBGET integrated database retrieval system