Williamsia herbipolensis: OG579_07445 Help Entry OG579_07445       CDS       T09708                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism whr  Williamsia herbipolensis Pathway whr00261   Monobactam biosynthesis whr01100   Metabolic pathways whr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:whr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OG579_07445  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:whr01008]     OG579_07445 Polyketide biosynthesis proteins [BR:whr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OG579_07445 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WUM21603 LinkDB All DBs Position complement(1669390..1669611) Genome browser AA seq 73 aa AA seqDB search MSNPFDDENGRFFVLVNAENQHSLWPTFVDIPAGWDKVFGEASRAECLDYVNEHWTDLRP KSLIEAMEADSAQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcccttcgacgacgagaacggccgcttcttcgtgctggtgaacgcggagaac cagcactccctgtggcccaccttcgtcgacatccccgcgggctgggacaaggtgttcggc gaggcgtcgcgtgcggagtgcctcgactacgtcaacgagcactggaccgacctgcggccc aagagcctgatcgaggccatggaggccgattcggcgcagtga

DBGET integrated database retrieval system