Xanthomonas albilineans: XALC_1065 Help Entry XALC_1065         CDS       T01160                                  Name (GenBank) putative mbth-like protein   KO K05375   MbtH protein Organism xal  Xanthomonas albilineans Pathway xal00261   Monobactam biosynthesis xal01100   Metabolic pathways xal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     XALC_1065  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xal01008]     XALC_1065 Polyketide biosynthesis proteins [BR:xal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     XALC_1065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CBA15580 UniProt:  D2UD66 LinkDB All DBs Position 1246727..1246945 Genome browser AA seq 72 aa AA seqDB search MSIQDDEQDHNYVVVINHEEQYALWPDYADVPNGWSVVFGPNPKQACLDYVNEHWTDMRP KSLRDAMAAAGH NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcaatccaagacgacgaacaagatcataactatgtcgtggtgatcaaccacgaggag cagtacgcattgtggccggactatgccgacgtcccgaatgggtggtcggtggtgttcggc cccaatccgaagcaggcttgcttggattatgtcaacgagcactggaccgatatgcgtccg aaaagcctgcgcgatgcgatggcggcggcggggcactga

DBGET integrated database retrieval system