Ahniella affigens: C7S18_08025 Help Entry C7S18_08025       CDS       T05483                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism xba  Ahniella affigens Pathway xba00261   Monobactam biosynthesis xba01100   Metabolic pathways xba01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xba00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C7S18_08025  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xba01008]     C7S18_08025 Polyketide biosynthesis proteins [BR:xba01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C7S18_08025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVP97143 UniProt:  A0A2P1PQL7 LinkDB All DBs Position complement(2083431..2083643) Genome browser AA seq 70 aa AA seqDB search MFDNENTIFKAVINHEEQYSIWPADRENPLGWRDAGKVGTKQECLDFIAQVWTDMRPLSL RKHMESVAQA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtttgacaacgaaaacaccatcttcaaggccgtgatcaaccacgaagaacagtactcg atctggcccgctgatcgcgaaaaccccttgggctggcgcgatgccggcaaagtgggcacg aagcaggaatgcttggatttcatcgctcaggtttggaccgacatgcgtccgttgagcctg cgaaagcacatggaatcggtcgcgcaagcctga

DBGET integrated database retrieval system