Xanthobacter dioxanivorans: EZH22_22230 Help Entry EZH22_22230       CDS       T07733                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism xdi  Xanthobacter dioxanivorans Pathway xdi00261   Monobactam biosynthesis xdi01100   Metabolic pathways xdi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xdi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     EZH22_22230  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xdi01008]     EZH22_22230 Polyketide biosynthesis proteins [BR:xdi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     EZH22_22230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH MC_hydratase Motif Other DBs NCBI-ProteinID:  QRG09793 UniProt:  A0A974PU20 LinkDB All DBs Position 4761266..4761472 Genome browser AA seq 68 aa AA seqDB search MMDDQHVNPFDDERHLFLALVNAAGQYSLWPAFRDVPAGWRVVHGPDTRAACLAHIESVW LDLMPVAG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgatggacgaccagcacgtcaatcccttcgacgacgagcgccacctcttcctggcgctg gtcaacgccgccggccagtacagcctgtggcccgccttccgcgatgtgcccgccggctgg cgggtggtgcacggcccggatacccgcgccgcctgcctcgcgcacatcgagagcgtctgg ctcgatctcatgcctgtcgccggctga

DBGET integrated database retrieval system