Xenorhabdus griffiniae: QL128_17870 Help Entry QL128_17870       CDS       T09400                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism xgr  Xenorhabdus griffiniae Pathway xgr00261   Monobactam biosynthesis xgr01100   Metabolic pathways xgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xgr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QL128_17870  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xgr01008]     QL128_17870 Polyketide biosynthesis proteins [BR:xgr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QL128_17870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WMV71964 LinkDB All DBs Position complement(3916160..3916414) Genome browser AA seq 84 aa AA seqDB search MNLEQKNPFDDDEATFYVLINNQQQYSLWPTFAAQPAGWERVIGPDSRAACIAYIEEHWV DMRPASLRNFDLRQPSARTTDKSN NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatttggaacaaaagaatccttttgatgatgacgaagccactttttatgtactgata aataatcaacaacaatatagcctttggccgacttttgccgcacaacccgccggctgggag cgggttattggcccagattcacgggccgcttgtatcgcatacatagaagagcattgggtg gatatgcgtccggctagtctgcgcaatttcgatctgcgtcaaccatctgcgcgaaccaca gataaatcaaactga

DBGET integrated database retrieval system