Xenorhabdus hominickii: A9255_16955 Help Entry A9255_16955       CDS       T04538                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism xho  Xenorhabdus hominickii Pathway xho00261   Monobactam biosynthesis xho01100   Metabolic pathways xho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xho00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A9255_16955  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xho01008]     A9255_16955 Polyketide biosynthesis proteins [BR:xho01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A9255_16955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AOM42094 UniProt:  A0A2G0QFU5 LinkDB All DBs Position 3729537..3729719 Genome browser AA seq 60 aa AA seqDB search MGQLTGNDDMNWRVVVNVKKQYSVWPTEFEIPMGWMATGKTGSKEECLSHIAEIWPEPTN NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggggcaattaacaggaaacgatgacatgaactggagagttgtcgtgaacgtcaaaaag cagtattcggtctggcctactgagtttgagatccctatgggatggatggcaacaggtaag acaggatctaaagaagagtgcttgagccatattgctgagatttggccggaacccacaaat tag

DBGET integrated database retrieval system