Xenorhabdus nematophila ATCC 19061: XNC1_0647 Help Entry XNC1_0647         CDS       T01274                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism xne  Xenorhabdus nematophila ATCC 19061 Pathway xne00261   Monobactam biosynthesis xne01100   Metabolic pathways xne01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xne00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     XNC1_0647  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xne01008]     XNC1_0647 Polyketide biosynthesis proteins [BR:xne01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     XNC1_0647 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CBJ88718 UniProt:  D3VJG2 LinkDB All DBs Position 563048..563230 Genome browser AA seq 60 aa AA seqDB search MKQLTGNDAMNWMVVLNGKKQYSVWPTEYDIPVGWMATGRTGSKDDCLNHIAAIWPEPTK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgaaacagttaaccggaaacgatgccatgaattggatggttgtgctcaatggtaaaaag cagtattcggtctggccgacggaatatgacattccggtggggtggatggcaacgggcaga acgggatctaaagatgattgcctgaatcatattgctgccatttggccggaacccacaaaa tag

DBGET integrated database retrieval system