Xanthomonas theicola: G4Q83_12650 Help Entry G4Q83_12650       CDS       T06965                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism xth  Xanthomonas theicola Pathway xth00261   Monobactam biosynthesis xth01100   Metabolic pathways xth01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xth00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G4Q83_12650  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:xth01008]     G4Q83_12650 Polyketide biosynthesis proteins [BR:xth01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G4Q83_12650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNH25421 LinkDB All DBs Position 2688061..2688279 Genome browser AA seq 72 aa AA seqDB search MAITPDDTTPYKAVVNHEEQYSVWPLDRNNAPGWRDTGVSGTKAECLAYIERVWIDMRPS SLRQHMQDQGLG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggcgatcaccccggacgatacgactccctataaggccgtagtcaatcacgaagaacag tattccgtctggcccctggaccggaacaacgcgccaggttggcgtgataccggggtgtcg ggcaccaaggccgagtgcctggcctacatcgagcgagtgtggatcgacatgcggccgtcg agcctacgtcagcacatgcaagaccaaggtctcggttga

DBGET integrated database retrieval system