Salipiger sp. CCB-MM3: AYJ57_20435 Help Entry AYJ57_20435       CDS       T04443                                  Name (GenBank) hypothetical protein   KO K00230   menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3] Organism yan  Salipiger sp. CCB-MM3 Pathway yan00860   Porphyrin metabolism yan01100   Metabolic pathways yan01110   Biosynthesis of secondary metabolites yan01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:yan00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     AYJ57_20435 Enzymes [BR:yan01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.5  With a quinone or related compound as acceptor     1.3.5.3  protoporphyrinogen IX dehydrogenase (quinone)      AYJ57_20435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flavodoxin_5 Flavodoxin_1 Motif Other DBs NCBI-ProteinID:  ANT62859 UniProt:  A0A1B1PW80 LinkDB All DBs Position unnamed1:complement(7153..7437) Genome browser AA seq 94 aa AA seqDB search MKVLIGYATHQGQTRKIARLVAAQIIDAGNSVELIPLIEALDIDLGSFDRVVLAASVHAN EYQRSLTEFAAQEVDRLNRMPSLFSLEVSANRVG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcctgatcggctacgcaacacaccaaggccagacacgaaaaatcgcccgtctc gtcgcagctcagatcattgacgctggcaactcggtcgaactgatacctttgatcgaagcc ctggacatcgacctgggaagcttcgaccgagtggttctggccgcctccgtacacgccaac gaatatcagagatcacttacagaatttgccgcacaggaagtcgatcgcctcaatcgcatg ccatcgcttttttctttggaggtgtccgcaaaccgtgttggttga

DBGET integrated database retrieval system