Yersinia canariae: F0T03_18535 Help Entry F0T03_18535       CDS       T06446                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism yca  Yersinia canariae Pathway yca00261   Monobactam biosynthesis yca01100   Metabolic pathways yca01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yca00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     F0T03_18535  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:yca01008]     F0T03_18535 Polyketide biosynthesis proteins [BR:yca01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     F0T03_18535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QHB33956 UniProt:  A0A857F2N1 LinkDB All DBs Position complement(3963733..3963963) Genome browser AA seq 76 aa AA seqDB search MNNETPTNPFDNEELPFFVLINEQQQYSLWPQITAIPAGWAVVHGPQSRADCVKYLEVNW TDMRPASLIRAEAGLR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaacaatgaaacaccaacaaacccgtttgataatgaagaactgcccttttttgtgctg atcaatgagcagcagcaatacagtttatggccccaaatcacggcgatccccgcaggatgg gcggttgttcatggccctcagagccgagcggactgtgtgaaatatcttgaggttaattgg accgacatgcgcccggccagtttgattcgcgccgaggctggcctgcgctaa

DBGET integrated database retrieval system