Yersinia entomophaga: PL78_09735 Help Entry PL78_09735        CDS       T09771                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism yeg  Yersinia entomophaga Pathway yeg00261   Monobactam biosynthesis yeg01100   Metabolic pathways yeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yeg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PL78_09735  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:yeg01008]     PL78_09735 Polyketide biosynthesis proteins [BR:yeg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PL78_09735 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANI30100 UniProt:  A0A3S6F1R9 LinkDB All DBs Position complement(2139124..2139345) Genome browser AA seq 73 aa AA seqDB search MNEAQVNPFDDESIPFFVLINAQRQYSLWPEITAIPAGWEPVFGPAVREACVRYLEMNWT DMRPQRLMNAQPE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaatgaagcccaagtgaacccttttgatgatgaaagcattcccttttttgtgctgatc aacgctcagcgccagtacagcctgtggcctgaaatcactgcgattcccgccggttgggaa ccggtatttggtccggcggtaagggaagcctgcgtacgctatctggaaatgaactggacg gatatgcgccctcagcgcctgatgaatgctcaaccggaataa

DBGET integrated database retrieval system