Yersinia enterocolitica LC20: LC20_00745 Help Entry LC20_00745        CDS       T03179                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism yel  Yersinia enterocolitica LC20 Pathway yel00261   Monobactam biosynthesis yel01100   Metabolic pathways yel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yel00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LC20_00745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:yel01008]     LC20_00745 Polyketide biosynthesis proteins [BR:yel01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LC20_00745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHM72001 UniProt:  A0A7U4GCV8 LinkDB All DBs Position complement(679246..679476) Genome browser AA seq 76 aa AA seqDB search MNNEAPTNPFDNENLPFFVLINEQQQYSLWPQITAIPAGWAVVHGPQSRADCVKYLEVNW TDMRPASLIRAELGLR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaacaatgaagcaccaaccaacccgtttgataacgaaaatctgcccttttttgtgctg atcaatgagcagcagcaatacagcttgtggccacaaattacggcgatccccgccggatgg gcagttgttcatggcccacagagccgagccgattgtgtgaaatatcttgaggttaattgg actgacatgcgcccggccagtttgattcgggcagagcttggcctgcgctaa

DBGET integrated database retrieval system