Yersinia frederiksenii: AW19_2625 Help Entry AW19_2625         CDS       T03606                                  Symbol mbtH Name (GenBank) mbtH domain protein   KO K05375   MbtH protein Organism yfr  Yersinia frederiksenii Pathway yfr00261   Monobactam biosynthesis yfr01100   Metabolic pathways yfr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yfr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AW19_2625 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:yfr01008]     AW19_2625 (mbtH) Polyketide biosynthesis proteins [BR:yfr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AW19_2625 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJI86330 LinkDB All DBs Position complement(2841993..2842244) Genome browser AA seq 83 aa AA seqDB search MNIYAMNNETETPTNPFDNEDLPFFVLINEQQQYSLWPQITAIPAGWEIVHGPQSRADCV KYLEVNWADMRPASLIRAEAGLQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacatttacgccatgaacaatgaaacagaaacacccaccaacccgtttgataacgaa gatctgcctttttttgtgctgataaatgagcagcagcaatacagcttgtggccccaaatt acggcgattccggcaggatgggaaattgttcatgggccgcaaagccgggcagattgtgtg aaatatcttgaggttaattgggccgacatgcgcccggccagtttgattcgtgcagaggct ggcctgcaataa

DBGET integrated database retrieval system