Yersinia hibernica: D5F51_19220 Help Entry D5F51_19220       CDS       T05961                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism yhi  Yersinia hibernica Pathway yhi00261   Monobactam biosynthesis yhi01100   Metabolic pathways yhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yhi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D5F51_19220  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:yhi01008]     D5F51_19220 Polyketide biosynthesis proteins [BR:yhi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D5F51_19220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QAX80467 UniProt:  A0A481QI81 LinkDB All DBs Position complement(4063511..4063741) Genome browser AA seq 76 aa AA seqDB search MNNEAPTNPFDNENLPFFVLINEQQQYSLWPQITAIPAGWAVVHGPQSRADCVKYLEVNW TDMRPASLIRAELGLR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaacaatgaagcgccaaccaacccgtttgataacgaaaatctgcccttttttgtgctg atcaatgagcagcagcaatacagcttgtggccacaaattacggcgatccccgccggatgg gcagttgttcatggcccacagagccgagccgattgtgtgaaatatcttgaggttaattgg actgacatgcgcccggccagtttgattcgggcagagcttggcctgcgctaa

DBGET integrated database retrieval system