Yinghuangia sp. ASG 101: LO772_01645 Help Entry LO772_01645       CDS       T07749                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism yia  Yinghuangia sp. ASG 101 Pathway yia00261   Monobactam biosynthesis yia01100   Metabolic pathways yia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:yia00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LO772_01645  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:yia01008]     LO772_01645 Polyketide biosynthesis proteins [BR:yia01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LO772_01645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UGQ12341 LinkDB All DBs Position 384809..385039 Genome browser AA seq 76 aa AA seqDB search MTDPREDTAGTFTVLVNDEGQHSLWPAVHAAPAGWAVVHGPDTRERCLAYVDDHWTDMRP KSLIEHADEYAKVRSA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgaccgatccccgggaggacaccgccggcacgttcacggtgctggtcaacgacgaaggc cagcactcgctgtggccggcggtccacgccgcgcccgccgggtgggccgtcgtccacggg cccgacacgcgcgaacggtgcctggcctatgtcgacgaccactggaccgacatgcgcccc aagagcctgatcgagcacgccgacgagtacgcgaaggtgcgatccgcatga

DBGET integrated database retrieval system