Yersinia rochesterensis: CH54_3163 Help Entry CH54_3163         CDS       T03609                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism ykr  Yersinia rochesterensis Pathway ykr00261   Monobactam biosynthesis ykr01100   Metabolic pathways ykr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ykr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CH54_3163  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ykr01008]     CH54_3163 Polyketide biosynthesis proteins [BR:ykr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CH54_3163 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJJ34433 LinkDB All DBs Position 3437343..3437594 Genome browser AA seq 83 aa AA seqDB search MNIYAMNNETETPTNPFDNEDLPFFVLINEQQQYSLWPQITAIPAGWEIVHGPQSRADCV KYLEVNWADMRPASLIRAEAGLQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacatttacgccatgaacaatgaaacagaaacacccaccaacccgtttgataacgaa gatctgcctttttttgtgctgataaatgagcagcagcaatacagcttgtggccccaaatt acggcgattccggcaggatgggaaattgttcatgggccgcaaagccgggcagattgtgtg aaatatcttgaggttaattgggccgacatgcgcccggccagtttgattcgtgcagaggct ggcctgcaataa

DBGET integrated database retrieval system