Alloyangia pacifica: CEW88_15925 Help Entry CEW88_15925       CDS       T05431                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism ypac  Alloyangia pacifica Pathway ypac00260   Glycine, serine and threonine metabolism ypac01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:ypac00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     CEW88_15925 Enzymes [BR:ypac01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      CEW88_15925     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      CEW88_15925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  AWI85230 UniProt:  A0A2U8HHX8 LinkDB All DBs Position 2:644189..644491 Genome browser AA seq 100 aa AA seqDB search MLLIHCPYCDETLPEVEFTYAGEAHIARPETPSEMSDEDWQQFLFMRANVKGDHFERWRH LHGCGRFFNAVRNTITDKFLTTYKAGAPRPDLAALKEGLK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgctcctgattcattgcccctattgtgacgagacgctgcccgaggtcgagttcacctat gccggcgaggcgcatattgcccgccccgaaaccccctcggagatgagcgacgaggactgg cagcagttcctcttcatgcgcgccaacgtcaagggcgaccatttcgagcgctggcgccac ctgcatggctgcgggcggtttttcaacgccgtgcgcaacaccatcaccgacaagttcctc accacctacaaggcgggcgcgccccgtcccgatctcgccgcgctgaaggagggcctgaaa tga

DBGET integrated database retrieval system