Zygotorulaspora mrakii: HG535_0F05170 Help Entry HG535_0F05170     CDS       T06976                                  Name (RefSeq) uncharacterized protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism zmk  Zygotorulaspora mrakii Pathway zmk03020   RNA polymerase zmk03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:zmk00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     HG535_0F05170   09124 Replication and repair    03420 Nucleotide excision repair     HG535_0F05170  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:zmk03021]     HG535_0F05170    03400 DNA repair and recombination proteins [BR:zmk03400]     HG535_0F05170 Transcription machinery [BR:zmk03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      HG535_0F05170   RNA polymerase III system    RNA polymerase III      HG535_0F05170   RNA polymerase I system    RNA polymerase I      HG535_0F05170 DNA repair and recombination proteins [BR:zmk03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       HG535_0F05170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  59237763 NCBI-ProteinID:  XP_037145730 LinkDB All DBs Position 6:1003031..1003243 Genome browser AA seq 70 aa AA seqDB search MIVPVRCFSCGKVVGDKWESYLTMLQEDELDEGTALTKLGLKRYCCRRMILTHVDLIEKF LRYNPLERRD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgattgttcctgttagatgtttctcgtgcggcaaagttgttggtgacaagtgggagagt tacctaaccatgttgcaagaggatgagttggatgaaggtacagctctaacaaagttgggt ttgaaaagatactgctgtagaagaatgatcctcacacacgttgacctgattgagaagttt ttgagatacaacccattggaaagaagggattga

DBGET integrated database retrieval system