Zootoca vivipara (common lizard): 118094849 Help Entry 118094849         CDS       T07275                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism zvi  Zootoca vivipara (common lizard) Pathway zvi04010   MAPK signaling pathway zvi04012   ErbB signaling pathway zvi04068   FoxO signaling pathway zvi04137   Mitophagy - animal zvi04140   Autophagy - animal zvi04150   mTOR signaling pathway zvi04210   Apoptosis zvi04218   Cellular senescence zvi04370   VEGF signaling pathway zvi04371   Apelin signaling pathway zvi04540   Gap junction zvi04625   C-type lectin receptor signaling pathway zvi04810   Regulation of actin cytoskeleton zvi04910   Insulin signaling pathway zvi04912   GnRH signaling pathway zvi04914   Progesterone-mediated oocyte maturation zvi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:zvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118094849    04012 ErbB signaling pathway     118094849    04370 VEGF signaling pathway     118094849    04371 Apelin signaling pathway     118094849    04068 FoxO signaling pathway     118094849    04150 mTOR signaling pathway     118094849  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118094849    04137 Mitophagy - animal     118094849   09143 Cell growth and death    04210 Apoptosis     118094849    04218 Cellular senescence     118094849   09144 Cellular community - eukaryotes    04540 Gap junction     118094849   09142 Cell motility    04810 Regulation of actin cytoskeleton     118094849  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118094849   09152 Endocrine system    04910 Insulin signaling pathway     118094849    04912 GnRH signaling pathway     118094849    04914 Progesterone-mediated oocyte maturation     118094849    04916 Melanogenesis     118094849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:zvi04131]     118094849   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:zvi04031]     118094849 Membrane trafficking [BR:zvi04131]  Endocytosis   Macropinocytosis    Ras GTPases     118094849 GTP-binding proteins [BR:zvi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118094849 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Motif Other DBs NCBI-GeneID:  118094849 NCBI-ProteinID:  XP_034991443 LinkDB All DBs Position LG13:complement(30422270..30430170) Genome browser AA seq 186 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHHYREQINRVKDSDDVPMVLVGNKCDL PSRTVDTKQAQELARSYGIPFVETSAKTRQGVEDAFYTLVREIRKHKEKISNGRKKKSSK RKCIIL NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaaactggtggtggtgggtgctggtggtgttgggaagagtgcattgact atacagttgattcagaatcactttgtggacgagtatgatcccactatagaggattcatac cggaagcaagtggtaatcgatggagagacgtgtctcttggatatcttggacacagctggg caagaggagtacagtgctatgcgtgaccagtacatgaggacaggagaaggcttcctctgt gtctttgcaatcaacaacacaaagtctttcgaagatgttcaccactacagggagcagatc aaccgtgtgaaggactccgatgatgttccgatggtgcttgttggcaataaatgtgatctg ccctcccggacggtggatacaaaacaagcccaggagcttgccagaagctacggaatcccc tttgtagagacctctgccaaaaccagacagggagtggaggatgctttctacaccctggtg cgagaaatccgaaaacacaaggaaaagatcagcaatgggcgcaagaagaaatcttccaaa aggaagtgtattatcctctga

DBGET integrated database retrieval system