Bacteroides faecium: BacF7301_15385 Help Entry BacF7301_15385    CDS       T08751                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bfc  Bacteroides faecium Pathway bfc00020   Citrate cycle (TCA cycle) bfc01100   Metabolic pathways bfc01110   Biosynthesis of secondary metabolites bfc01120   Microbial metabolism in diverse environments bfc01200   Carbon metabolism bfc01210   2-Oxocarboxylic acid metabolism Module bfc_M00009   Citrate cycle (TCA cycle, Krebs cycle) bfc_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:bfc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BacF7301_15385 Enzymes [BR:bfc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BacF7301_15385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_2 Fer4_6 Fer4_7 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_8 Fer4_22 Fer4_17 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  QIU95447 UniProt:  A0A6H0KSP0 LinkDB All DBs Position complement(4231570..4231797) Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLDVIALNKEVNMKGYNYAWQVKEDTCNGCSSCAT VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcaaaggagcaatcgtagtcgacacggagcgttgcaaaggatgcaacctg tgtgtagtggcgtgtccgctcgatgtaatcgccctcaacaaagaggtaaatatgaaaggc tataactatgcctggcaagtgaaagaagatacctgcaacggatgcagctcgtgcgcaacg gtttgtccggacggatgtatctcagtgtataaagtaaaagtagaataa

DBGET integrated database retrieval system