Desmodus rotundus (common vampire bat): 112319119 Help Entry 112319119         CDS       T05907                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism dro  Desmodus rotundus (common vampire bat) Pathway dro01522   Endocrine resistance dro04110   Cell cycle dro04115   p53 signaling pathway dro04151   PI3K-Akt signaling pathway dro04218   Cellular senescence dro04530   Tight junction dro04660   T cell receptor signaling pathway dro04933   AGE-RAGE signaling pathway in diabetic complications dro04934   Cushing syndrome dro05160   Hepatitis C dro05162   Measles dro05163   Human cytomegalovirus infection dro05164   Influenza A dro05165   Human papillomavirus infection dro05166   Human T-cell leukemia virus 1 infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05169   Epstein-Barr virus infection dro05200   Pathways in cancer dro05203   Viral carcinogenesis dro05212   Pancreatic cancer dro05214   Glioma dro05218   Melanoma dro05219   Bladder cancer dro05220   Chronic myeloid leukemia dro05222   Small cell lung cancer dro05223   Non-small cell lung cancer dro05224   Breast cancer dro05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     112319119 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     112319119 (CDK4)    04115 p53 signaling pathway     112319119 (CDK4)    04218 Cellular senescence     112319119 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     112319119 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     112319119 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112319119 (CDK4)    05203 Viral carcinogenesis     112319119 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     112319119 (CDK4)    05225 Hepatocellular carcinoma     112319119 (CDK4)    05214 Glioma     112319119 (CDK4)    05220 Chronic myeloid leukemia     112319119 (CDK4)    05218 Melanoma     112319119 (CDK4)    05219 Bladder cancer     112319119 (CDK4)    05224 Breast cancer     112319119 (CDK4)    05222 Small cell lung cancer     112319119 (CDK4)    05223 Non-small cell lung cancer     112319119 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112319119 (CDK4)    05160 Hepatitis C     112319119 (CDK4)    05164 Influenza A     112319119 (CDK4)    05162 Measles     112319119 (CDK4)    05163 Human cytomegalovirus infection     112319119 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     112319119 (CDK4)    05169 Epstein-Barr virus infection     112319119 (CDK4)    05165 Human papillomavirus infection     112319119 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112319119 (CDK4)    04934 Cushing syndrome     112319119 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     112319119 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:dro01001]     112319119 (CDK4) Enzymes [BR:dro01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      112319119 (CDK4) Protein kinases [BR:dro01001]  Serine/threonine kinases: CMGC group   CDK family    112319119 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  112319119 NCBI-ProteinID:  XP_024432162 LinkDB All DBs Position Unknown AA seq 303 aa AA seqDB search MATLRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPVSTVREVALL RRLEAFEHPNVVRLVDVCATSRTDRETRVTLVFEHVDQDLRTYLDKVPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSMIPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG SPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacccttcgatacgagccagtggctgagattggtgttggtgcctatgggacggtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagcgtgagagtcccc aatggaggaggtgctggagggggccttcccgtcagcacagttcgtgaggtggccttactg aggcggctggaagcttttgagcatcccaatgttgtccggctggtggacgtctgtgccacc tcccggactgacagagagaccagagtgaccctggtgtttgagcatgtggaccaagacctg aggacgtatctggacaaggtacccccaccaggcttgccagtggagaccattaaggatctg atgcgccagtttctaagaggcctggatttccttcatgccaactgcattgttcaccgggac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggccgactttggc ctggccagaatctacagctaccagatggcactcacacctgtggttgttacactctggtac cgtgctccggaagttcttttgcagtctgcgtatgcaacaccggtggacttgtggagtgtt ggctgtatctttgcagagatgtttcgccgaaagcctctcttctgcggaaactctgaagct gaccaattaagcaaaatatttgatctgatcgggctgcccccagaggatgactggccccga gacgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtccatg atacctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cataagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt agcccagagtga

DBGET integrated database retrieval system