Methanobacterium sp. MZ-A1: BK008_06270 Help Entry BK008_06270       CDS       T05317                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism metn  Methanobacterium sp. MZ-A1 Pathway metn00280   Valine, leucine and isoleucine degradation metn01100   Metabolic pathways metn01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:metn00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     BK008_06270 Enzymes [BR:metn01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      BK008_06270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_2 Fer4_6 Fer4 Fer4_22 Fer4_13 Fer4_4 Fer4_8 Fer4_3 Fer4_17 Motif Other DBs NCBI-ProteinID:  AUB57960 UniProt:  A0A2H4VIQ9 LinkDB All DBs Position 1283531..1283821 Genome browser AA seq 96 aa AA seqDB search MTSRKKEPYPVFNELECKACERCILACRPSVLKMSEDINERGYHYAVYQGEGCTGCGDCY YTCPEPLAVEVHIPQKIRNKDQNKPTNDKGDKENIK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacaagtcgcaagaaagaaccctatccagttttcaatgaactggaatgtaaggcatgt gaacgttgcatattagcctgccgtccaagtgtccttaagatgagtgaagacatcaatgaa cgaggttaccattatgcagtttatcagggagaaggatgcactggttgcggggactgttac tacacctgccccgaacccctagcagtggaagttcacataccccaaaaaattagaaacaaa gaccagaataaaccaaccaacgataaaggggataaggagaatattaaatga

DBGET integrated database retrieval system